Class a: All alpha proteins [46456] (289 folds) |
Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
Superfamily a.116.1: GTPase activation domain, GAP [48350] (3 families) |
Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (6 proteins) Pfam PF00620 |
Protein p50 RhoGAP domain [48352] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries) |
Domain d1tx4a_: 1tx4 A: [19098] Other proteins in same PDB: d1tx4b_ complexed with alf, gdp, mg |
PDB Entry: 1tx4 (more details), 1.65 Å
SCOPe Domain Sequences for d1tx4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens) [TaxId: 9606]} plpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqq kynmglpvdfdqynalhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlq vlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainp intftkflldhqgelf
Timeline for d1tx4a_: