![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.116: GTPase activation domain, GAP [48349] (1 superfamily) multihelical |
![]() | Superfamily a.116.1: GTPase activation domain, GAP [48350] (2 families) ![]() |
![]() | Family a.116.1.1: BCR-homology GTPase activation domain (BH-domain) [48351] (4 proteins) |
![]() | Protein p50 RhoGAP domain [48352] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48353] (4 PDB entries) |
![]() | Domain d1tx4a_: 1tx4 A: [19098] Other proteins in same PDB: d1tx4b_ complexed with alf, gdp, mg |
PDB Entry: 1tx4 (more details), 1.65 Å
SCOP Domain Sequences for d1tx4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tx4a_ a.116.1.1 (A:) p50 RhoGAP domain {Human (Homo sapiens)} plpnqqfgvslqhlqeknpeqepipivlretvaylqahalttegifrrsantqvvrevqq kynmglpvdfdqynalhlpavilktflrelpeplltfdlyphvvgflnidesqrvpatlq vlqtlpeenyqvlrfltaflvqisahsdqnkmtntnlavvfgpnllwakdaaitlkainp intftkflldhqgelf
Timeline for d1tx4a_: