Lineage for d2btve1 (2btv E:1-120,E:255-349)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5987Fold a.115: Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain [48344] (1 superfamily)
  4. 5988Superfamily a.115.1: Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain [48345] (1 family) (S)
  5. 5989Family a.115.1.1: Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain [48346] (1 protein)
  6. 5990Protein Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain [48347] (1 species)
  7. 5991Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)
  8. 6000Domain d2btve1: 2btv E:1-120,E:255-349 [19089]
    Other proteins in same PDB: d2btva_, d2btvb_, d2btvc2, d2btvd2, d2btve2, d2btvf2, d2btvg2, d2btvh2, d2btvi2, d2btvj2, d2btvp2, d2btvq2, d2btvr2, d2btvs2, d2btvt2

Details for d2btve1

PDB Entry: 2btv (more details), 3.5 Å

PDB Description: atomic model for bluetongue virus (btv) core

SCOP Domain Sequences for d2btve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btve1 a.115.1.1 (E:1-120,E:255-349) Bluetongue virus coat protein vp7 (BTV-10 vp7), alpha-helical domain {Bluetongue virus}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtairnrttlpnmlppifppndrdsiltllll
stladvytvlrpefamhgvnpmpgpltaaiaraayv

SCOP Domain Coordinates for d2btve1:

Click to download the PDB-style file with coordinates for d2btve1.
(The format of our PDB-style files is described here.)

Timeline for d2btve1: