Lineage for d1bvp51 (1bvp 5:1-120,5:255-349)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
    multihelical; three-helical bundle in the core is surrounded by non-conserved helices
  4. Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) (S)
    this domain is interrupted by a jelly-roll beta-sandwich domain
  5. Family a.115.1.1: Orbivirus capsid [48346] (1 protein)
  6. Protein BTV vp7 [48347] (1 species)
  7. Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)
  8. Domain d1bvp51: 1bvp 5:1-120,5:255-349 [19083]
    Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62

Details for d1bvp51

PDB Entry: 1bvp (more details), 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7
PDB Compounds: (5:) bluetongue virus coat protein vp7

SCOPe Domain Sequences for d1bvp51:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvp51 a.115.1.1 (5:1-120,5:255-349) BTV vp7 {Bluetongue virus [TaxId: 40051]}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv

SCOPe Domain Coordinates for d1bvp51 are not available.

Timeline for d1bvp51:

Domains from same chain:
(mouse over for more information)
d1bvp52
Domains from other chains:
(mouse over for more information)
d1bvp11, d1bvp12, d1bvp21, d1bvp22, d1bvp31, d1bvp32, d1bvp41, d1bvp42, d1bvp61, d1bvp62