| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily) multihelical; three-helical bundle in the core is surrounded by non-conserved helices |
Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) ![]() this domain is interrupted by a jelly-roll beta-sandwich domain |
| Family a.115.1.1: Orbivirus capsid [48346] (1 protein) |
| Protein BTV vp7 [48347] (1 species) |
| Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries) |
| Domain d1bvp31: 1bvp 3:1-120,3:255-349 [19081] Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62 |
PDB Entry: 1bvp (more details), 2.6 Å
SCOPe Domain Sequences for d1bvp31:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvp31 a.115.1.1 (3:1-120,3:255-349) BTV vp7 {Bluetongue virus [TaxId: 40051]}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv
Timeline for d1bvp31: