Lineage for d1bvp21 (1bvp 2:1-120,2:255-349)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447322Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
    multihelical; three-helical bundle in the core is surrounded by non-conserved helices
  4. 447323Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (3 families) (S)
    this domain is interrupted by a jelly-roll beta-sandwich domain
  5. 447324Family a.115.1.1: Orbivirus capsid [48346] (1 protein)
  6. 447325Protein BTV vp7 [48347] (1 species)
  7. 447326Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)
  8. 447328Domain d1bvp21: 1bvp 2:1-120,2:255-349 [19080]
    Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62

Details for d1bvp21

PDB Entry: 1bvp (more details), 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

SCOP Domain Sequences for d1bvp21:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvp21 a.115.1.1 (2:1-120,2:255-349) BTV vp7 {Bluetongue virus}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv

SCOP Domain Coordinates for d1bvp21:

Click to download the PDB-style file with coordinates for d1bvp21.
(The format of our PDB-style files is described here.)

Timeline for d1bvp21: