Lineage for d1bvp21 (1bvp 2:1-120,2:255-349)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily) Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (2 families) 
Family a.115.1.1: Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48346] (1 protein) Protein Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48347] (1 species) Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries) 
Domain d1bvp21: 1bvp 2:1-120,2:255-349 [19080]
Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62
Details for d1bvp21
PDB Entry: 1bvp (more details), 2.6 Å
PDB Description: the crystal structure of bluetongue virus vp7
SCOP Domain Sequences for d1bvp21:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvp21 a.115.1.1 (2:1-120,2:255-349) Bluetongue virus capsid protein vp7 (BTV-10 vp7) {Bluetongue virus}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv
SCOP Domain Coordinates for d1bvp21:
Click to download the PDB-style file with coordinates for d1bvp21.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bvp21:
View in 3D
