Lineage for d1bvp11 (1bvp 1:1-120,1:255-349)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100475Fold a.115: A virus capsid protein alpha-helical domain [48344] (1 superfamily)
  4. 100476Superfamily a.115.1: A virus capsid protein alpha-helical domain [48345] (2 families) (S)
  5. 100477Family a.115.1.1: Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48346] (1 protein)
  6. 100478Protein Bluetongue virus capsid protein vp7 (BTV-10 vp7) [48347] (1 species)
  7. 100479Species Bluetongue virus [TaxId:40051] [48348] (2 PDB entries)
  8. 100480Domain d1bvp11: 1bvp 1:1-120,1:255-349 [19079]
    Other proteins in same PDB: d1bvp12, d1bvp22, d1bvp32, d1bvp42, d1bvp52, d1bvp62

Details for d1bvp11

PDB Entry: 1bvp (more details), 2.6 Å

PDB Description: the crystal structure of bluetongue virus vp7

SCOP Domain Sequences for d1bvp11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvp11 a.115.1.1 (1:1-120,1:255-349) Bluetongue virus capsid protein vp7 (BTV-10 vp7) {Bluetongue virus}
mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
Xktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifppndrdsiltllll
stladvytvlrpefaihgvnpmpgpltraiaraayv

SCOP Domain Coordinates for d1bvp11:

Click to download the PDB-style file with coordinates for d1bvp11.
(The format of our PDB-style files is described here.)

Timeline for d1bvp11: