Lineage for d1dg3a1 (1dg3 A:284-583)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1744963Fold a.114: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48339] (1 superfamily)
    multihelical; bundle of longer and shorter helices
  4. 1744964Superfamily a.114.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48340] (2 families) (S)
    automatically mapped to Pfam PF02841
  5. 1744965Family a.114.1.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48341] (1 protein)
  6. 1744966Protein Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48342] (1 species)
  7. 1744967Species Human (Homo sapiens) [TaxId:9606] [48343] (2 PDB entries)
  8. 1744969Domain d1dg3a1: 1dg3 A:284-583 [19078]
    Other proteins in same PDB: d1dg3a2

Details for d1dg3a1

PDB Entry: 1dg3 (more details), 1.8 Å

PDB Description: structure of human guanylate binding protein-1 in nucleotide free form
PDB Compounds: (A:) protein (interferon-induced guanylate-binding protein 1)

SCOPe Domain Sequences for d1dg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dg3a1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ggiqvngprleslvltyvnaissgdlpcmenavlalaqiensaavqkaiahyeqqmgqkv
qlpteslqelldlhrdsereaievfirssfkdvdhlfqkelaaqlekkrddfckqnqeas
sdrcsgllqvifspleeevkagiyskpggyrlfvqklqdlkkkyyeeprkgiqaeeilqt
ylkskesmtdailqtdqtltekekeievervkaesaqasakmlhemqrkneqmmeqkers
yqehlkqltekmendrvqllkeqertlalklqeqeqllkegfqkesrimkneiqdlqtkm

SCOPe Domain Coordinates for d1dg3a1:

Click to download the PDB-style file with coordinates for d1dg3a1.
(The format of our PDB-style files is described here.)

Timeline for d1dg3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dg3a2