Lineage for d1f5na1 (1f5n A:284-583)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725173Fold a.114: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48339] (1 superfamily)
    multihelical; bundle of longer and shorter helices
  4. 2725174Superfamily a.114.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48340] (2 families) (S)
    automatically mapped to Pfam PF02841
  5. 2725175Family a.114.1.1: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48341] (2 proteins)
  6. 2725176Protein Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain [48342] (1 species)
  7. 2725177Species Human (Homo sapiens) [TaxId:9606] [48343] (2 PDB entries)
  8. 2725178Domain d1f5na1: 1f5n A:284-583 [19077]
    Other proteins in same PDB: d1f5na2
    complexed with gnp, mg

Details for d1f5na1

PDB Entry: 1f5n (more details), 1.7 Å

PDB Description: human guanylate binding protein-1 in complex with the gtp analogue, gmppnp.
PDB Compounds: (A:) interferon-induced guanylate-binding protein 1

SCOPe Domain Sequences for d1f5na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ggiqvngprleslvltyvnaissgdlpcmenavlalaqiensaavqkaiahyeqqmgqkv
qlpteslqelldlhrdsereaievfirssfkdvdhlfqkelaaqlekkrddfckqnqeas
sdrcsgllqvifspleeevkagiyskpggyrlfvqklqdlkkkyyeeprkgiqaeeilqt
ylkskesmtdailqtdqtltekekeievervkaesaqasakmlhemqrkneqmmeqkers
yqehlkqltekmendrvqllkeqertlalklqeqeqllkegfqkesrimkneiqdlqtkm

SCOPe Domain Coordinates for d1f5na1:

Click to download the PDB-style file with coordinates for d1f5na1.
(The format of our PDB-style files is described here.)

Timeline for d1f5na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f5na2