Lineage for d1ewqb1 (1ewq B:1267-1541)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447287Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 447288Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 447289Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 447290Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 447306Species Thermus aquaticus [TaxId:271] [48337] (4 PDB entries)
  8. 447308Domain d1ewqb1: 1ewq B:1267-1541 [19070]
    Other proteins in same PDB: d1ewqa2, d1ewqa3, d1ewqa4, d1ewqb2, d1ewqb3, d1ewqb4
    CASP4

Details for d1ewqb1

PDB Entry: 1ewq (more details), 2.2 Å

PDB Description: crystal structure taq muts complexed with a heteroduplex dna at 2.2 a resolution

SCOP Domain Sequences for d1ewqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewqb1 a.113.1.1 (B:1267-1541) DNA repair protein MutS, domain III {Thermus aquaticus}
rgqdtlfsvldetrtapgrrllqswlrhplldrgplearldrvegfvregalregvrrll
yrladlerlatrlelgraspkdlgalrrslqilpelrallgeevglpdlsplkeeleaal
vedpplkvseggliregydpdldalraahregvayfleleererertgiptlkvgynavf
gyylevtrpyyervpkeyrpvqtlkdrqrytlpemkekerevyrlealirrreeevflev
rerakrqaealreaarilaeldvyaalaevavryg

SCOP Domain Coordinates for d1ewqb1:

Click to download the PDB-style file with coordinates for d1ewqb1.
(The format of our PDB-style files is described here.)

Timeline for d1ewqb1: