Lineage for d1siga_ (1sig A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014239Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2014240Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2014241Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 protein domains)
  6. 2014257Protein Sigma70 [88948] (2 species)
  7. 2014258Species Escherichia coli [TaxId:562] [48332] (1 PDB entry)
  8. 2014259Domain d1siga_: 1sig A: [19068]
    sigma2 domain only with a large insert subdomain

Details for d1siga_

PDB Entry: 1sig (more details), 2.6 Å

PDB Description: crystal structure of a sigma70 subunit fragment from escherichia coli rna polymerase
PDB Compounds: (A:) RNA polymerase primary sigma factor

SCOPe Domain Sequences for d1siga_:

Sequence, based on SEQRES records: (download)

>d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]}
megeidiakriedginqvqcsvaeypeaitylleqynrveaeearlsdlitgfvdpnaee
dlaptathvgselsqedldddededeedgdddsadddnsidpelarekfaelraqyvvtr
dtikakgrshataqeeilklsevfkqfrlvpkqfdylvnsmrvmmdrvrtqerlimklcv
eqckmpkknfitlftgnetsdtwfnaaiamnkpwseklhdvseevhralqklqqieeetg
ltieqvkdinrrmsigeakarrakkemveanlrlvisiakkytnrglqfldliqegnigl
mkavdkfeyrrgykfstyatwwirqaitrsiadq

Sequence, based on observed residues (ATOM records): (download)

>d1siga_ a.177.1.1 (A:) Sigma70 {Escherichia coli [TaxId: 562]}
megeidiakriedginqvqcsvaeypeaitylleqynrveaeearlsdlitgfvddlapt
athvgselsqedldidpelarekfaelraqyvvtrdtikahataqeeilklsevfkqfrl
vpkqfdylvnsmrvmmdrvrtqerlimklcveqckmpkknfitlftgnetsdtwfnaaia
mnkpwseklhdvseevhralqklqqieeetgltieqvkdinrrmsigeakarrakkemve
anlrlvisiakkytnrglqfldliqegniglmkavdkfeyrrgykfstyatwwirqaitr
siadq

SCOPe Domain Coordinates for d1siga_:

Click to download the PDB-style file with coordinates for d1siga_.
(The format of our PDB-style files is described here.)

Timeline for d1siga_: