Lineage for d1vnca_ (1vnc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006107Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2006108Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2006139Family a.111.1.3: Chloroperoxidase [48325] (2 protein domains)
    duplication: contains two core bundles arranged as in the other family dimer
  6. 2006140Protein Chloroperoxidase [48326] (1 species)
  7. 2006141Species Curvularia inaequalis [TaxId:38902] [48327] (9 PDB entries)
  8. 2006147Domain d1vnca_: 1vnc A: [19065]
    complexed with azi, vo4

Details for d1vnca_

PDB Entry: 1vnc (more details), 2.1 Å

PDB Description: chloroperoxidase from the fungus curvularia inaequalis
PDB Compounds: (A:) vanadium-containing chloroperoxidase

SCOPe Domain Sequences for d1vnca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vnca_ a.111.1.3 (A:) Chloroperoxidase {Curvularia inaequalis [TaxId: 38902]}
svtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhlaih
dayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveqpn
pnpganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgasqe
gyhptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehfla
dppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtppr
fynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwrpl
sgvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyngr
vgtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsawel
mfenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgtre
deeglfpiggvplgieiadeifnnglkptppeiqpm

SCOPe Domain Coordinates for d1vnca_:

Click to download the PDB-style file with coordinates for d1vnca_.
(The format of our PDB-style files is described here.)

Timeline for d1vnca_: