Lineage for d1vnsa_ (1vns A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006107Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2006108Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2006139Family a.111.1.3: Chloroperoxidase [48325] (2 protein domains)
    duplication: contains two core bundles arranged as in the other family dimer
  6. 2006140Protein Chloroperoxidase [48326] (1 species)
  7. 2006141Species Curvularia inaequalis [TaxId:38902] [48327] (9 PDB entries)
  8. 2006142Domain d1vnsa_: 1vns A: [19061]
    complexed with so4

Details for d1vnsa_

PDB Entry: 1vns (more details), 1.66 Å

PDB Description: recombinant apo-chloroperoxidase from curvularia inaequalis
PDB Compounds: (A:) vanadium chloroperoxidase

SCOPe Domain Sequences for d1vnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vnsa_ a.111.1.3 (A:) Chloroperoxidase {Curvularia inaequalis [TaxId: 38902]}
vtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgpplsaralgmlhlaihd
ayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlsslymkpveqpnp
npganisdnayaqlglvldrsvleapggvdresasfmfgedvadvffallndprgasqeg
yhptpgrykfddepthpvvlipvdpnnpngpkmpfrqyhapfygkttkrfatqsehflad
ppglrsnadetaeyddavrvaiamggaqalnstkrspwqtaqglywaydgsnligtpprf
ynqivrriavtykkeedlansevnnadfarlfalvdvactdagifswkekwefefwrpls
gvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggavfqmvrryyngrv
gtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhfdsawelm
fenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgtred
eeglfpiggvplgieiadeifnnglkptppeiqp

SCOPe Domain Coordinates for d1vnsa_:

Click to download the PDB-style file with coordinates for d1vnsa_.
(The format of our PDB-style files is described here.)

Timeline for d1vnsa_: