Lineage for d1qhbe_ (1qhb E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006107Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2006108Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2006122Family a.111.1.2: Haloperoxidase (bromoperoxidase) [48321] (1 protein)
    contains one core bundle; forms dimer
  6. 2006123Protein Haloperoxidase (bromoperoxidase) [48322] (3 species)
  7. 2006127Species Red algae (Corallina officinalis) [TaxId:35170] [48324] (1 PDB entry)
  8. 2006132Domain d1qhbe_: 1qhb E: [19059]
    complexed with ca, po4

Details for d1qhbe_

PDB Entry: 1qhb (more details), 2.3 Å

PDB Description: vanadium bromoperoxidase from red alga corallina officinalis
PDB Compounds: (E:) haloperoxidase

SCOPe Domain Sequences for d1qhbe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qhbe_ a.111.1.2 (E:) Haloperoxidase (bromoperoxidase) {Red algae (Corallina officinalis) [TaxId: 35170]}
gipadnlqsrakasfdtrvaaaelalargavpsfangeellyrnsetgdpsfigsftkgl
phddngaiidpddflafvrainsgdekeiaaltlgpardpetglpiwrsdlansldlevr
gwenssagltfdlegpdaqsvamppapvltspeliaemaelylmalgrdiefsefdspkn
aafirsaierlnglewfntpaklgdppaeirrrrgevtvgnlfrgilpgsevgpylsqfi
ivgskqigsatvgnktlvspnaadefdgeiaygsitisqrvriatpgrdfmtdlkvfldv
qdaadfrgfesyepgarlirtirdlatwvhfdslyeaylnaclillangvpfdpnlpfqq
edkldnqdvfvnfgsahvlslvtevatralkavryqkfnihrrlrpeatgglisvnknaf
lksesvfpevdvlveelssilddsassnekqniadgdvspgksfllpmafaegspfhpsy
gsghavvagacvtilkaffdanfqidqvfevdtdedklvkssfpgpltvagelnkladnv
aigrnmagvhyfsdqfeslllgeqiaigileeqsltygenfffnlpkfdgttiqi

SCOPe Domain Coordinates for d1qhbe_:

Click to download the PDB-style file with coordinates for d1qhbe_.
(The format of our PDB-style files is described here.)

Timeline for d1qhbe_: