Lineage for d1qi9a_ (1qi9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006107Fold a.111: Acid phosphatase/Vanadium-dependent haloperoxidase [48316] (1 superfamily)
    multihelical; core: 5-helical bundle; binds cofactor at the beginning of third helix
  4. 2006108Superfamily a.111.1: Acid phosphatase/Vanadium-dependent haloperoxidase [48317] (4 families) (S)
  5. 2006122Family a.111.1.2: Haloperoxidase (bromoperoxidase) [48321] (1 protein)
    contains one core bundle; forms dimer
  6. 2006123Protein Haloperoxidase (bromoperoxidase) [48322] (3 species)
  7. 2006124Species Ascophyllum nodosum [TaxId:52969] [48323] (1 PDB entry)
  8. 2006125Domain d1qi9a_: 1qi9 A: [19053]
    complexed with iod, vo4

Details for d1qi9a_

PDB Entry: 1qi9 (more details), 2.05 Å

PDB Description: x-ray siras structure determination of a vanadium-dependent haloperoxidase from ascophyllum nodosum at 2.0 a resolution
PDB Compounds: (A:) protein (vanadium bromoperoxidase)

SCOPe Domain Sequences for d1qi9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qi9a_ a.111.1.2 (A:) Haloperoxidase (bromoperoxidase) {Ascophyllum nodosum [TaxId: 52969]}
tcstsddaddptppnerddeafasrvaaakrelegtgtvcqinngetdlaakfhkslphd
dlgqvdadafaaledcilngdlsicedvpvgnsegdpvgrlvnptaafaidisgpafsat
tippvptlpspelaaqlaevywmalardvpfmqygtdditvtaaanlagmegfpnldavs
igsdgtvdplsqlfratfvgvetgpfisqllvnsftidsitvepkqetfapdvnymvdfd
ewlniqnggppagpellddelrfvrnardlarvtftdninteayrgalillgldafnrag
vngpfididrqagfvnfgishyfrligaaelaqrsswyqkwqvhrfarpealggtlhlti
kgelnadfdlsllenaellkrvaainaaqnpnnevtyllpqaiqegspthpsypsghatq
ngafatvlkaligldrggdcypdpvypdddglklidfrgscltfegeinklavnvafgrq
mlgihyrfdgiqglllgetitvrtlhqelmtfaeestfefrlftgeviklfqdgtftidg
fkcpglvytgvencv

SCOPe Domain Coordinates for d1qi9a_:

Click to download the PDB-style file with coordinates for d1qi9a_.
(The format of our PDB-style files is described here.)

Timeline for d1qi9a_: