Lineage for d1b25d1 (1b25 D:211-619)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006090Fold a.110: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48309] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2006091Superfamily a.110.1: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48310] (1 family) (S)
    automatically mapped to Pfam PF01314
  5. 2006092Family a.110.1.1: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48311] (2 protein domains)
  6. 2006097Protein Formaldehyde ferredoxin oxidoreductase [48314] (1 species)
  7. 2006098Species Pyrococcus furiosus [TaxId:2261] [48315] (2 PDB entries)
  8. 2006102Domain d1b25d1: 1b25 D:211-619 [19047]
    Other proteins in same PDB: d1b25a2, d1b25b2, d1b25c2, d1b25d2
    complexed with ptt, sf4

Details for d1b25d1

PDB Entry: 1b25 (more details), 1.85 Å

PDB Description: formaldehyde ferredoxin oxidoreductase from pyrococcus furiosus
PDB Compounds: (D:) protein (formaldehyde ferredoxin oxidoreductase)

SCOPe Domain Sequences for d1b25d1:

Sequence, based on SEQRES records: (download)

>d1b25d1 a.110.1.1 (D:211-619) Formaldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
dkeelkklsqeayneilnspgypfwkrqgtmaavewcntnyalptrnfsdgyfefarsid
gytmegmkvqqrgcpycnmpcgnvvldaegqeseldyenvallgsnlgigklnevsvlnr
iademgmdtislgvsiahvmeavergilkegptfgdfkgakqlaldiayrkgelgnlaae
gvkamaeklgthdfamhvkglevsgyncyiypamalaygtsaigahhkeawviaweigta
piegekaekveykisydpikaqkvvelqrlrgglfemltacrlpwvevglsldyypkllk
aitgvtytwddlykaadrvysliraywvrefngkwdrkmdyppkrwfteglksgphkgeh
ldekkydellseyyrirgwdergipkketlkeldldfvipelekvtnle

Sequence, based on observed residues (ATOM records): (download)

>d1b25d1 a.110.1.1 (D:211-619) Formaldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
dkeelkklsqeayneilnspgypfwkrqgtmaavewcntnyalptrnfsdgyfefarsid
gytmegmkvqqrgcpycnmpcgnvvldaegqeseldyenvallgsnlgigklnevsvlnr
iademgmdtislgvsiahvmeavergilkegptfgdfkgakqlaldiayrkgelgnlaae
gvkamaeklgthdfamhvkglevsgyncyiypamalaygtsaigahhkeawviaweigta
pieykisydpikaqkvvelqrlrgglfemltacrlpwvevglsldyypkllkaitgvtyt
wddlykaadrvysliraywvrefngkwdrkmdyppkrwfteglksgphkgehldekkyde
llseyyrirgwdergipkketlkeldldfvipelekvtnle

SCOPe Domain Coordinates for d1b25d1:

Click to download the PDB-style file with coordinates for d1b25d1.
(The format of our PDB-style files is described here.)

Timeline for d1b25d1: