Lineage for d1aorb1 (1aor B:211-605)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.110: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48309] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.110.1: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48310] (1 family) (S)
    automatically mapped to Pfam PF01314
  5. Family a.110.1.1: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48311] (2 proteins)
  6. Protein Aldehyde ferredoxin oxidoreductase [48312] (1 species)
  7. Species Pyrococcus furiosus [TaxId:2261] [48313] (1 PDB entry)
  8. Domain d1aorb1: 1aor B:211-605 [19043]
    Other proteins in same PDB: d1aora2, d1aorb2
    complexed with fe, na, pte, sf4

Details for d1aorb1

PDB Entry: 1aor (more details), 2.3 Å

PDB Description: structure of a hyperthermophilic tungstopterin enzyme, aldehyde ferredoxin oxidoreductase
PDB Compounds: (B:) aldehyde ferredoxin oxidoreductase

SCOPe Domain Sequences for d1aorb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aorb1 a.110.1.1 (B:211-605) Aldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
iadkqkfmlvvrekvnklrndpvaggglpkygtavlvniinenglypvknfqtgvypyay
eqsgeamaakylvrnkpcyacpigcgrvnrlptvgetegpeyesvwalganlgindlasi
ieanhmcdelgldtistggtlatamelyekghikdeelgdappfrwgntevlhyyiekia
kregfgdklaegsyrlaesyghpelsmtvkklelpaydprgaeghglgyatnnrggchik
nymispeilgypykmdphdvsddkikmlilfqdltalidsaglclfttfglgaddyrdll
naalgwdfttedylkigeriwnaerlfnlkagldparddtlpkrfleepmpegpnkghtv
rlkemlpryyklrgwtedgkipkekleelgiaefy

SCOPe Domain Coordinates for d1aorb1 are not available.

Timeline for d1aorb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aorb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1aora1, d1aora2