Lineage for d1aora1 (1aor A:211-605)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338141Fold a.110: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48309] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2338142Superfamily a.110.1: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48310] (1 family) (S)
    automatically mapped to Pfam PF01314
  5. 2338143Family a.110.1.1: Aldehyde ferredoxin oxidoreductase, C-terminal domains [48311] (2 proteins)
  6. 2338144Protein Aldehyde ferredoxin oxidoreductase [48312] (1 species)
  7. 2338145Species Pyrococcus furiosus [TaxId:2261] [48313] (1 PDB entry)
  8. 2338146Domain d1aora1: 1aor A:211-605 [19042]
    Other proteins in same PDB: d1aora2, d1aorb2
    complexed with fe, na, pte, sf4

Details for d1aora1

PDB Entry: 1aor (more details), 2.3 Å

PDB Description: structure of a hyperthermophilic tungstopterin enzyme, aldehyde ferredoxin oxidoreductase
PDB Compounds: (A:) aldehyde ferredoxin oxidoreductase

SCOPe Domain Sequences for d1aora1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aora1 a.110.1.1 (A:211-605) Aldehyde ferredoxin oxidoreductase {Pyrococcus furiosus [TaxId: 2261]}
iadkqkfmlvvrekvnklrndpvaggglpkygtavlvniinenglypvknfqtgvypyay
eqsgeamaakylvrnkpcyacpigcgrvnrlptvgetegpeyesvwalganlgindlasi
ieanhmcdelgldtistggtlatamelyekghikdeelgdappfrwgntevlhyyiekia
kregfgdklaegsyrlaesyghpelsmtvkklelpaydprgaeghglgyatnnrggchik
nymispeilgypykmdphdvsddkikmlilfqdltalidsaglclfttfglgaddyrdll
naalgwdfttedylkigeriwnaerlfnlkagldparddtlpkrfleepmpegpnkghtv
rlkemlpryyklrgwtedgkipkekleelgiaefy

SCOPe Domain Coordinates for d1aora1:

Click to download the PDB-style file with coordinates for d1aora1.
(The format of our PDB-style files is described here.)

Timeline for d1aora1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aora2