Lineage for d1iiec_ (1iie C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006082Fold a.109: Class II MHC-associated invariant chain ectoplasmic trimerization domain [48304] (1 superfamily)
    multihelical; intertwined trimer of identical 3-helical subunits
  4. 2006083Superfamily a.109.1: Class II MHC-associated invariant chain ectoplasmic trimerization domain [48305] (1 family) (S)
    automatically mapped to Pfam PF08831
  5. 2006084Family a.109.1.1: Class II MHC-associated invariant chain ectoplasmic trimerization domain [48306] (1 protein)
  6. 2006085Protein Class II MHC-associated invariant chain ectoplasmic trimerization domain [48307] (1 species)
  7. 2006086Species Human (Homo sapiens) [TaxId:9606] [48308] (1 PDB entry)
  8. 2006089Domain d1iiec_: 1iie C: [19041]

Details for d1iiec_

PDB Entry: 1iie (more details)

PDB Description: hla-dr antigens associated invariant chain
PDB Compounds: (C:) protein (hla-dr antigens associated invariant chain)

SCOPe Domain Sequences for d1iiec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iiec_ a.109.1.1 (C:) Class II MHC-associated invariant chain ectoplasmic trimerization domain {Human (Homo sapiens) [TaxId: 9606]}
ygnmtedhvmhllqnadplkvypplkgsfpenlrhlkntmetidwkvfeswmhhwllfem
srhsleqkptdappk

SCOPe Domain Coordinates for d1iiec_:

Click to download the PDB-style file with coordinates for d1iiec_.
(The format of our PDB-style files is described here.)

Timeline for d1iiec_: