![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily) multihelical; intertwined tetramer |
![]() | Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) ![]() |
![]() | Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein) |
![]() | Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [48303] (6 PDB entries) |
![]() | Domain d1dd4d_: 1dd4 D: [19038] Other proteins in same PDB: d1dd4a2, d1dd4b2 complexed with tbr |
PDB Entry: 1dd4 (more details), 2.4 Å
SCOPe Domain Sequences for d1dd4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dd4d_ a.108.1.1 (D:) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]} mtideiieaiekltvselaelvkkledkfgvtaaapvava
Timeline for d1dd4d_: