Lineage for d1dd4b1 (1dd4 B:1-57)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725010Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
    multihelical; intertwined tetramer
  4. 2725011Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. 2725012Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. 2725013Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)
  7. 2725025Species Thermotoga maritima [TaxId:2336] [48303] (6 PDB entries)
  8. 2725049Domain d1dd4b1: 1dd4 B:1-57 [19036]
    Other proteins in same PDB: d1dd4a2, d1dd4b2
    complexed with tbr

Details for d1dd4b1

PDB Entry: 1dd4 (more details), 2.4 Å

PDB Description: Crystal structure of ribosomal protein l12 from thermotoga maritim
PDB Compounds: (B:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1dd4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd4b1 a.108.1.1 (B:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

SCOPe Domain Coordinates for d1dd4b1:

Click to download the PDB-style file with coordinates for d1dd4b1.
(The format of our PDB-style files is described here.)

Timeline for d1dd4b1: