Lineage for d1dd4a1 (1dd4 A:1-57)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
  4. Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family) (S)
  5. Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)
  6. Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (1 species)
  7. Species Thermotoga maritima [TaxId:243274] [48303] (2 PDB entries)
  8. Domain d1dd4a1: 1dd4 A:1-57 [19035]
    Other proteins in same PDB: d1dd4a2, d1dd4b2

Details for d1dd4a1

PDB Entry: 1dd4 (more details), 2.4 Å

PDB Description: Crystal structure of ribosomal protein l12 from thermotoga maritim

SCOP Domain Sequences for d1dd4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd4a1 a.108.1.1 (A:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

SCOP Domain Coordinates for d1dd4a1 are not available.

Timeline for d1dd4a1:

Domains from same chain:
(mouse over for more information)
d1dd4a2
Domains from other chains:
(mouse over for more information)
d1dd4b1, d1dd4b2, d1dd4c1, d1dd4d1