SCOP 1.55: Domain d1wrsr_: 1wrs R:

Lineage for d1wrsr_ (1wrs R:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.107: Trp repressor [48294] (1 superfamily)

4. Superfamily a.107.1: Trp repressor [48295] (1 family)

5. Family a.107.1.1: Trp repressor [48296] (1 protein)

6. Protein Trp repressor [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (9 PDB entries)

8. Domain d1wrsr_: 1wrs R: [19027]

Details for d1wrsr_

PDB Entry: 1wrs

PDB Description: nmr study of holo trp repressor

SCOP Domain Sequences for d1wrsr_:

Sequence; same for both SEQRES and ATOM records:

>d1wrsr_ a.107.1.1 (R:) Trp repressor {Escherichia coli}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknelgagiatitrgsnslkaapvelrqwleevllks

Timeline for d1wrsr_:

• d1wrsr_ appears in SCOP 1.57
  
• d1wrsr_ appears in the current release, SCOPe 2.08