| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.12: TrpR-like [48295] (4 families) ![]() contains an extra shared helix after the HTH motif |
| Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins) intertwined dimer of identical 6-helical subunits automatically mapped to Pfam PF01371 |
| Protein Trp repressor, TrpR [48297] (1 species) |
| Species Escherichia coli [TaxId:562] [48298] (19 PDB entries) |
| Domain d1rcsb_: 1rcs B: [19026] protein/DNA complex; complexed with trp |
PDB Entry: 1rcs (more details)
SCOPe Domain Sequences for d1rcsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcsb_ a.4.12.1 (B:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknelgagiatitrgsnslkaapvelrqwleevllks
Timeline for d1rcsb_: