Lineage for d1rcsa_ (1rcs A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.107: Trp repressor [48294] (1 superfamily) Superfamily a.107.1: Trp repressor [48295] (1 family) 
Family a.107.1.1: Trp repressor [48296] (1 protein) Protein Trp repressor [48297] (1 species) Species Escherichia coli [TaxId:562] [48298] (9 PDB entries) 
Domain d1rcsa_: 1rcs A: [19025]
Details for d1rcsa_
PDB Entry: 1rcs (more details)
PDB Description: nmr study of trp repressor-operator dna complex
SCOP Domain Sequences for d1rcsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcsa_ a.107.1.1 (A:) Trp repressor {Escherichia coli}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknelgagiatitrgsnslkaapvelrqwleevllks
SCOP Domain Coordinates for d1rcsa_:
Click to download the PDB-style file with coordinates for d1rcsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rcsa_:
- d1rcsa_ appears in SCOP 1.57
- d1rcsa_ appears in the current release, SCOPe 2.08
View in 3D
