SCOPe 2.08: Domain d1rcsa_: 1rcs A:

Lineage for d1rcsa_ (1rcs A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein Trp repressor, TrpR [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (19 PDB entries)

8. Domain d1rcsa_: 1rcs A: [19025]
   protein/DNA complex; complexed with trp

Details for d1rcsa_

PDB Entry: 1rcs

PDB Description: nmr study of trp repressor-operator dna complex

PDB Compounds: (A:) trp repressor

SCOPe Domain Sequences for d1rcsa_:

Sequence; same for both SEQRES and ATOM records:

>d1rcsa_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
gemsqrelknelgagiatitrgsnslkaapvelrqwleevllks

Timeline for d1rcsa_:

• d1rcsa_ first appeared (with stable ids) in SCOP 1.55
  
• d1rcsa_ appears in SCOPe 2.07