SCOP 1.55: Domain d1trrg_: 1trr G:

Lineage for d1trrg_ (1trr G:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.107: Trp repressor [48294] (1 superfamily)

4. Superfamily a.107.1: Trp repressor [48295] (1 family)

5. Family a.107.1.1: Trp repressor [48296] (1 protein)

6. Protein Trp repressor [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (9 PDB entries)

8. Domain d1trrg_: 1trr G: [19021]

Details for d1trrg_

PDB Entry: 1trr, 2.4 Å

PDB Description: tandem binding in crystals of a trp repressor/operator half-site complex

SCOP Domain Sequences for d1trrg_:

Sequence; same for both SEQRES and ATOM records:

>d1trrg_ a.107.1.1 (G:) Trp repressor {Escherichia coli}
aqqspysaamaeqrheewlrfvdllknayqndlhlpllnlmltpderealgtrvriveel
lrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllk

SCOP Domain Coordinates for d1trrg_ are not available.

Timeline for d1trrg_:

• d1trrg_ appears in SCOP 1.57
  
• d1trrg_ appears in the current release, SCOPe 2.08