Lineage for d1trra_ (1trr A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695732Superfamily a.4.12: TrpR-like [48295] (4 families) (S)
    contains an extra shared helix after the HTH motif
  5. 2695733Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
    intertwined dimer of identical 6-helical subunits
    automatically mapped to Pfam PF01371
  6. 2695734Protein Trp repressor, TrpR [48297] (1 species)
  7. 2695735Species Escherichia coli [TaxId:562] [48298] (19 PDB entries)
  8. 2695762Domain d1trra_: 1trr A: [19017]
    protein/DNA complex; complexed with trp

Details for d1trra_

PDB Entry: 1trr (more details), 2.4 Å

PDB Description: tandem binding in crystals of a trp repressor/operator half-site complex
PDB Compounds: (A:) protein (trp repressor)

SCOPe Domain Sequences for d1trra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1trra_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
aqqspysaamaeqrheewlrfvdllknayqndlhlpllnlmltpderealgtrvriveel
lrgemsqrelknelgagiatitrgsnslkaapvelrqwleevllk

SCOPe Domain Coordinates for d1trra_:

Click to download the PDB-style file with coordinates for d1trra_.
(The format of our PDB-style files is described here.)

Timeline for d1trra_: