SCOPe 2.06: Domain d3wrpa_: 3wrp A:

Lineage for d3wrpa_ (3wrp A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein Trp repressor, TrpR [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (16 PDB entries)

8. Domain d3wrpa_: 3wrp A: [19015]

Details for d3wrpa_

PDB Entry: 3wrp, 1.8 Å

PDB Description: flexibility of the dna-binding domains of trp repressor

PDB Compounds: (A:) trp repressor

SCOPe Domain Sequences for d3wrpa_:

Sequence; same for both SEQRES and ATOM records:

>d3wrpa_ a.4.12.1 (A:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
saamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrgems
qrelknelgagiatitrgsnslkaapvelrqwleevllksd

Timeline for d3wrpa_:

• d3wrpa_ first appeared (with stable ids) in SCOP 1.55, called d3wrp__
  
• d3wrpa_ appears in SCOPe 2.05
  
• d3wrpa_ appears in SCOPe 2.07
  
• d3wrpa_ appears in the current release, SCOPe 2.08