SCOP 1.55: Domain d1troe_: 1tro E:

Lineage for d1troe_ (1tro E:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.107: Trp repressor [48294] (1 superfamily)

4. Superfamily a.107.1: Trp repressor [48295] (1 family)

5. Family a.107.1.1: Trp repressor [48296] (1 protein)

6. Protein Trp repressor [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (9 PDB entries)

8. Domain d1troe_: 1tro E: [19013]

Details for d1troe_

PDB Entry: 1tro, 1.9 Å

PDB Description: crystal structure of trp repressor operator complex at atomic resolution

SCOP Domain Sequences for d1troe_:

Sequence; same for both SEQRES and ATOM records:

>d1troe_ a.107.1.1 (E:) Trp repressor {Escherichia coli}
aeerhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrgemsqrel
knelgagiatitrgsnslkaapvelrqwleevllksd

SCOP Domain Coordinates for d1troe_ are not available.

Timeline for d1troe_:

• d1troe_ appears in SCOP 1.57
  
• d1troe_ appears in the current release, SCOPe 2.08