SCOP 1.55: Domain d1troa_: 1tro A:

Lineage for d1troa_ (1tro A:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.107: Trp repressor [48294] (1 superfamily)

4. Superfamily a.107.1: Trp repressor [48295] (1 family)

5. Family a.107.1.1: Trp repressor [48296] (1 protein)

6. Protein Trp repressor [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (9 PDB entries)

8. Domain d1troa_: 1tro A: [19011]

Details for d1troa_

PDB Entry: 1tro, 1.9 Å

PDB Description: crystal structure of trp repressor operator complex at atomic resolution

SCOP Domain Sequences for d1troa_:

Sequence; same for both SEQRES and ATOM records:

>d1troa_ a.107.1.1 (A:) Trp repressor {Escherichia coli}
spysaamaeerhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrg
emsqrelknelgagiatitrgsnslkaapvelrqwleevllksd

SCOP Domain Coordinates for d1troa_ are not available.

Timeline for d1troa_:

• d1troa_ appears in SCOP 1.57
  
• d1troa_ appears in the current release, SCOPe 2.08