Class a: All alpha proteins [46456] (138 folds) |
Fold a.106: Pleiotropic regulator of virulence genes, SarA [48289] (1 superfamily) |
Superfamily a.106.1: Pleiotropic regulator of virulence genes, SarA [48290] (1 family) |
Family a.106.1.1: Pleiotropic regulator of virulence genes, SarA [48291] (1 protein) |
Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [48293] (2 PDB entries) |
Domain d1fzpb_: 1fzp B: [19008] |
PDB Entry: 1fzp (more details), 2.95 Å
SCOP Domain Sequences for d1fzpb_:
Sequence, based on SEQRES records: (download)
>d1fzpb_ a.106.1.1 (B:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus} aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrit
>d1fzpb_ a.106.1.1 (B:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus} aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrit
Timeline for d1fzpb_: