SCOPe 2.08: Domain d1fzpb_: 1fzp B:

Lineage for d1fzpb_ (1fzp B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species)
   closely related to SarR but adopts a different fold; possible experimental artifact?

7. Species Staphylococcus aureus [TaxId:1280] [48293] (3 PDB entries)

8. Domain d1fzpb_: 1fzp B: [19008]
   protein/DNA complex; complexed with ca
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d1fzpb_

PDB Entry: 1fzp, 2.95 Å

PDB Description: crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus

PDB Compounds: (B:) Staphylococcal accessory regulator A

SCOPe Domain Sequences for d1fzpb_:

Sequence, based on SEQRES records:

>d1fzpb_ a.4.5.28 (B:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrit

Sequence, based on observed residues (ATOM records):

>d1fzpb_ a.4.5.28 (B:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav
kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrvnkrit

Timeline for d1fzpb_:

• d1fzpb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fzpb_ appears in SCOPe 2.07