SCOP 1.69: Domain d1fzpd_: 1fzp D:

Lineage for d1fzpd_ (1fzp D:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.28: MarR-like transcriptional regulators [63379] (8 proteins)
   The N- and C-terminal helical extensions to the common fold form the dimer interface

6. Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species)
   closely related to SarR but adopts a different fold; possible experimental artifact?

7. Species Staphylococcus aureus [TaxId:1280] [48293] (1 PDB entry)

8. Domain d1fzpd_: 1fzp D: [19007]

Details for d1fzpd_

PDB Entry: 1fzp, 2.95 Å

PDB Description: crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus

SCOP Domain Sequences for d1fzpd_:

Sequence, based on SEQRES records:

>d1fzpd_ a.4.5.28 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv

Sequence, based on observed residues (ATOM records):

>d1fzpd_ a.4.5.28 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav
kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv

Timeline for d1fzpd_:

• d1fzpd_ first appeared (with stable ids) in SCOP 1.55
  
• d1fzpd_ appears in SCOP 1.67
  
• d1fzpd_ appears in SCOP 1.71
  
• d1fzpd_ appears in the current release, SCOPe 2.08