Lineage for d1fzpd_ (1fzp D:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 351986Family a.4.5.28: MarR-like transcriptional regulators [63379] (8 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 352003Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species)
    closely related to SarR but adopts a different fold; possible experimental artifact?
  7. 352004Species Staphylococcus aureus [TaxId:1280] [48293] (1 PDB entry)
  8. 352006Domain d1fzpd_: 1fzp D: [19007]

Details for d1fzpd_

PDB Entry: 1fzp (more details), 2.95 Å

PDB Description: crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus

SCOP Domain Sequences for d1fzpd_:

Sequence, based on SEQRES records: (download)

>d1fzpd_ a.4.5.28 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv

Sequence, based on observed residues (ATOM records): (download)

>d1fzpd_ a.4.5.28 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav
kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv

SCOP Domain Coordinates for d1fzpd_:

Click to download the PDB-style file with coordinates for d1fzpd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzpd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fzpb_