Lineage for d1fzpd_ (1fzp D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5859Fold a.106: Pleiotropic regulator of virulence genes, SarA [48289] (1 superfamily)
  4. 5860Superfamily a.106.1: Pleiotropic regulator of virulence genes, SarA [48290] (1 family) (S)
  5. 5861Family a.106.1.1: Pleiotropic regulator of virulence genes, SarA [48291] (1 protein)
  6. 5862Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species)
  7. 5863Species Staphylococcus aureus [TaxId:1280] [48293] (2 PDB entries)
  8. 5866Domain d1fzpd_: 1fzp D: [19007]

Details for d1fzpd_

PDB Entry: 1fzp (more details), 2.95 Å

PDB Description: crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus

SCOP Domain Sequences for d1fzpd_:

Sequence, based on SEQRES records: (download)

>d1fzpd_ a.106.1.1 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv

Sequence, based on observed residues (ATOM records): (download)

>d1fzpd_ a.106.1.1 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav
kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv

SCOP Domain Coordinates for d1fzpd_:

Click to download the PDB-style file with coordinates for d1fzpd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzpd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fzpb_