![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
![]() | Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species) closely related to SarR but adopts a different fold; possible experimental artifact? |
![]() | Species Staphylococcus aureus [TaxId:1280] [48293] (3 PDB entries) |
![]() | Domain d1fzpd_: 1fzp D: [19007] protein/DNA complex; complexed with ca heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures |
PDB Entry: 1fzp (more details), 2.95 Å
SCOPe Domain Sequences for d1fzpd_:
Sequence, based on SEQRES records: (download)
>d1fzpd_ a.4.5.28 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv
>d1fzpd_ a.4.5.28 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv
Timeline for d1fzpd_: