Lineage for d1fzpd_ (1fzp D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693746Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species)
    closely related to SarR but adopts a different fold; possible experimental artifact?
  7. 2693747Species Staphylococcus aureus [TaxId:1280] [48293] (3 PDB entries)
  8. 2693753Domain d1fzpd_: 1fzp D: [19007]
    protein/DNA complex; complexed with ca
    heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d1fzpd_

PDB Entry: 1fzp (more details), 2.95 Å

PDB Description: crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus
PDB Compounds: (D:) Staphylococcal accessory regulator A

SCOPe Domain Sequences for d1fzpd_:

Sequence, based on SEQRES records: (download)

>d1fzpd_ a.4.5.28 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhln
ykqpqvvkavkilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv

Sequence, based on observed residues (ATOM records): (download)

>d1fzpd_ a.4.5.28 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}
aitkindcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdivvkav
kilsqedyfdkkrnehdertvlilvnaqqrkkiesllsrv

SCOPe Domain Coordinates for d1fzpd_:

Click to download the PDB-style file with coordinates for d1fzpd_.
(The format of our PDB-style files is described here.)

Timeline for d1fzpd_: