Lineage for d1fznd_ (1fzn D:)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies) Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (31 families) 
Family a.4.5.28: MarR-like transcriptional regulators [63379] (2 proteins) 
Protein Pleiotropic regulator of virulence genes, SarA [48292] (1 species) Species Staphylococcus aureus [TaxId:1280] [48293] (2 PDB entries) 
Domain d1fznd_: 1fzn D: [19006]
Details for d1fznd_
PDB Entry: 1fzn (more details), 2.55 Å
PDB Description: crystal structures of sara: a pleiotropic regulator of virulence genes in s. aureus
SCOP Domain Sequences for d1fznd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fznd_ a.4.5.28 (D:) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus}
indcfellsmvtyadklkslikkefsisfeefavltyisenkekeyylkdiinhlnykqp
qvvkavkilsqedyfdkkrnehdertvlimvnaqqrkkiesllsrvnkriteanne
SCOP Domain Coordinates for d1fznd_:
Click to download the PDB-style file with coordinates for d1fznd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fznd_:
- d1fznd_ first appeared (with stable ids) in SCOP 1.55
- d1fznd_ does not appear in SCOP 1.59
View in 3D