SCOPe 2.05: Domain d1ntcb_: 1ntc B:

Lineage for d1ntcb_ (1ntc B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.12: FIS-like [100918] (4 proteins)

6. Protein DNA-binding domain of NTRC [48287] (1 species)
   includes N-terminal dimerisation subdomain

7. Species Salmonella typhimurium [TaxId:90371] [48288] (1 PDB entry)

8. Domain d1ntcb_: 1ntc B: [19005]

Details for d1ntcb_

PDB Entry: 1ntc

PDB Description: solution structure of the dna-binding domain of ntrc with three alanine substitutions

PDB Compounds: (B:) protein (nitrogen regulation protein (ntrc))

SCOPe Domain Sequences for d1ntcb_:

Sequence; same for both SEQRES and ATOM records:

>d1ntcb_ a.4.1.12 (B:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]}
mdlpgelfeastpdspshlppdswatllaqwadralrsghqnllseaqpelertllttal
rhtqghkqeaarllgwgaatltaklkelgme

Timeline for d1ntcb_:

• d1ntcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ntcb_ appears in SCOPe 2.04
  
• d1ntcb_ is called d1ntcb1 in SCOPe 2.06
  
• d1ntcb_ appears in the current release, SCOPe 2.08, called d1ntcb1