Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.12: FIS-like [100918] (4 proteins) |
Protein DNA-binding domain of NTRC [48287] (1 species) includes N-terminal dimerisation subdomain |
Species Salmonella typhimurium [TaxId:90371] [48288] (1 PDB entry) |
Domain d1ntcb_: 1ntc B: [19005] |
PDB Entry: 1ntc (more details)
SCOPe Domain Sequences for d1ntcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntcb_ a.4.1.12 (B:) DNA-binding domain of NTRC {Salmonella typhimurium [TaxId: 90371]} mdlpgelfeastpdspshlppdswatllaqwadralrsghqnllseaqpelertllttal rhtqghkqeaarllgwgaatltaklkelgme
Timeline for d1ntcb_: