Lineage for d1etqd_ (1etq D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5824Fold a.105: FIS-like [48282] (1 superfamily)
  4. 5825Superfamily a.105.1: FIS-like [48283] (1 family) (S)
  5. 5826Family a.105.1.1: FIS-like [48284] (2 proteins)
  6. 5831Protein FIS protein [48285] (1 species)
  7. 5832Species Escherichia coli [TaxId:562] [48286] (12 PDB entries)
  8. 5858Domain d1etqd_: 1etq D: [19003]

Details for d1etqd_

PDB Entry: 1etq (more details), 2.8 Å

PDB Description: the crystal structure of e. coli fis mutant r71y

SCOP Domain Sequences for d1etqd_:

Sequence, based on SEQRES records: (download)

>d1etqd_ a.105.1.1 (D:) FIS protein {Escherichia coli}
vltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqy
tygnqtraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records): (download)

>d1etqd_ a.105.1.1 (D:) FIS protein {Escherichia coli}
vltvstqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytygnqtra
almmginrgtlrkklkkygmn

SCOP Domain Coordinates for d1etqd_:

Click to download the PDB-style file with coordinates for d1etqd_.
(The format of our PDB-style files is described here.)

Timeline for d1etqd_: