SCOPe 2.06: Domain d1etqa_: 1etq A:

Lineage for d1etqa_ (1etq A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.12: FIS-like [100918] (4 proteins)

6. Protein FIS protein [48285] (2 species)
   includes N-terminal dimerisation subdomain

7. Species Escherichia coli [TaxId:562] [48286] (16 PDB entries)

8. Domain d1etqa_: 1etq A: [19000]
   mutant

Details for d1etqa_

PDB Entry: 1etq, 2.8 Å

PDB Description: the crystal structure of e. coli fis mutant r71y

PDB Compounds: (A:) factor for inversion stimulation

SCOPe Domain Sequences for d1etqa_:

Sequence, based on SEQRES records:

>d1etqa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]}
vltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqy
tygnqtraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records):

>d1etqa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]}
vltvstvnsqvtqkplrdsvkqalknyfaqlqdvndlyelvlaeveqplldmvmqytygn
qtraalmmginrgtlrkklkkygmn

Timeline for d1etqa_:

• d1etqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1etqa_ appears in SCOPe 2.05
  
• d1etqa_ appears in SCOPe 2.07
  
• d1etqa_ appears in the current release, SCOPe 2.08