SCOPe 2.05: Domain d4fisa_: 4fis A:

Lineage for d4fisa_ (4fis A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.12: FIS-like [100918] (4 proteins)

6. Protein FIS protein [48285] (2 species)
   includes N-terminal dimerisation subdomain

7. Species Escherichia coli [TaxId:562] [48286] (16 PDB entries)

8. Domain d4fisa_: 4fis A: [18996]
   mutant

Details for d4fisa_

PDB Entry: 4fis, 2.3 Å

PDB Description: the molecular structure of wild-type and a mutant fis protein: relationship between mutational changes and recombinational enhancer function or dna binding

PDB Compounds: (A:) factor for inversion stimulation (fis)

SCOPe Domain Sequences for d4fisa_:

Sequence; same for both SEQRES and ATOM records:

>d4fisa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]}
plrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytrgnqtraalmmginr
gtlckklkkygmn

Timeline for d4fisa_:

• d4fisa_ first appeared (with stable ids) in SCOP 1.55
  
• d4fisa_ appears in SCOPe 2.04
  
• d4fisa_ appears in SCOPe 2.06
  
• d4fisa_ appears in the current release, SCOPe 2.08