| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
| Family a.4.1.12: FIS-like [100918] (4 proteins) |
| Protein FIS protein [48285] (2 species) includes N-terminal dimerisation subdomain |
| Species Escherichia coli [TaxId:562] [48286] (16 PDB entries) |
| Domain d3fisa_: 3fis A: [18994] mutant |
PDB Entry: 3fis (more details), 2.3 Å
SCOPe Domain Sequences for d3fisa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fisa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]}
plrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytrgnqtraalmmginr
gtlrkklkkygmn
Timeline for d3fisa_: