Lineage for d1etkb_ (1etk B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.105: FIS-like [48282] (1 superfamily) Superfamily a.105.1: FIS-like [48283] (1 family) 
Family a.105.1.1: FIS-like [48284] (2 proteins) Protein FIS protein [48285] (1 species) Species Escherichia coli [TaxId:562] [48286] (12 PDB entries) 
Domain d1etkb_: 1etk B: [18993]
Details for d1etkb_
PDB Entry: 1etk (more details), 2.1 Å
PDB Description: the crystal structure of e. coli fis mutant q68a
SCOP Domain Sequences for d1etkb_:
Sequence, based on SEQRES records: (download)
>d1etkb_ a.105.1.1 (B:) FIS protein {Escherichia coli}
rvnsdvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplld
mvmaytrgnqtraalmmginrgtlrkklkkygmn
Sequence, based on observed residues (ATOM records): (download)
>d1etkb_ a.105.1.1 (B:) FIS protein {Escherichia coli}
rvnsdvltvkplrdsvkqalknyfaqdvndlyelvlaeveqplldmvmaytrgnqtraal
mmginrgtlrkklkkygmn
SCOP Domain Coordinates for d1etkb_:
Click to download the PDB-style file with coordinates for d1etkb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1etkb_:
- d1etkb_ appears in SCOP 1.57
- d1etkb_ appears in the current release, SCOPe 2.08
View in 3D
