Lineage for d1fiab_ (1fia B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692555Family a.4.1.12: FIS-like [100918] (4 proteins)
  6. 2692560Protein FIS protein [48285] (2 species)
    includes N-terminal dimerisation subdomain
  7. 2692588Species Escherichia coli [TaxId:562] [48286] (16 PDB entries)
  8. 2692608Domain d1fiab_: 1fia B: [18985]

Details for d1fiab_

PDB Entry: 1fia (more details), 2 Å

PDB Description: crystal structure of the factor for inversion stimulation fis at 2.0 angstroms resolution
PDB Compounds: (B:) factor for inversion stimulation (fis)

SCOPe Domain Sequences for d1fiab_:

Sequence, based on SEQRES records: (download)

>d1fiab_ a.4.1.12 (B:) FIS protein {Escherichia coli [TaxId: 562]}
vltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqy
trgnqtraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records): (download)

>d1fiab_ a.4.1.12 (B:) FIS protein {Escherichia coli [TaxId: 562]}
vltvkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytrgnqtraalm
mginrgtlrkklkkygmn

SCOPe Domain Coordinates for d1fiab_:

Click to download the PDB-style file with coordinates for d1fiab_.
(The format of our PDB-style files is described here.)

Timeline for d1fiab_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fiaa_