Lineage for d1etoa_ (1eto A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1721119Family a.4.1.12: FIS-like [100918] (4 proteins)
  6. 1721124Protein FIS protein [48285] (2 species)
    includes N-terminal dimerisation subdomain
  7. 1721152Species Escherichia coli [TaxId:562] [48286] (16 PDB entries)
  8. 1721157Domain d1etoa_: 1eto A: [18982]
    mutant

Details for d1etoa_

PDB Entry: 1eto (more details), 1.9 Å

PDB Description: the crystal structure of e. coli fis mutant r71l
PDB Compounds: (A:) factor for inversion stimulation

SCOPe Domain Sequences for d1etoa_:

Sequence, based on SEQRES records: (download)

>d1etoa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]}
dvltvstvnsqdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmq
ytlgnqtraalmmginrgtlrkklkkygmn

Sequence, based on observed residues (ATOM records): (download)

>d1etoa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]}
dvltvstvdqvtqkplrdsvkqalknyfaqlngqdvndlyelvlaeveqplldmvmqytl
gnqtraalmmginrgtlrkklkkygmn

SCOPe Domain Coordinates for d1etoa_:

Click to download the PDB-style file with coordinates for d1etoa_.
(The format of our PDB-style files is described here.)

Timeline for d1etoa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1etob_