Lineage for d1dt6a_ (1dt6 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1743742Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 1744164Protein Mammalian cytochrome p450 2c5 [48280] (1 species)
  7. 1744165Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [48281] (3 PDB entries)
  8. 1744168Domain d1dt6a_: 1dt6 A: [18977]
    complexed with hem, sm, so4

Details for d1dt6a_

PDB Entry: 1dt6 (more details), 3 Å

PDB Description: structure of mammalian cytochrome p450 2c5
PDB Compounds: (A:) cytochrome p450 2c5

SCOPe Domain Sequences for d1dt6a_:

Sequence, based on SEQRES records: (download)

>d1dt6a_ a.104.1.1 (A:) Mammalian cytochrome p450 2c5 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ppgptpfpiignilqidakdisksltkfsecygpvftvylgmkptvvlhgyeavkealvd
lgeefagrgsvpilekvskglgiafsnaktwkemrrfslmtlrnfgmgkrsiedriqeea
rclveelrktnaspcdptfilgcapcnvicsvifhnrfdykdeeflklmeslhenvellg
tpwlqvynnfpalldyfpgihktllknadyiknfimekvkehqklldvnnprdfidcfli
kmeqennleftleslviavsdlfgagtettsttlryslllllkhpevaarvqeeiervig
rhrspcmqdrsrmpytdaviheiqrfidllptnlphavtrdvrfrnyfipkgtdiitslt
svlhdekafpnpkvfdpghfldesgnfkksdyfmpfsagkrmcvgeglarmelflfltsi
lqnfklqslvepkdlditavvngfvsvppsyqlcfipihh

Sequence, based on observed residues (ATOM records): (download)

>d1dt6a_ a.104.1.1 (A:) Mammalian cytochrome p450 2c5 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ppgptpfpiignilqidakdisksltkfsecygpvftvylgmkptvvlhgyeavkealvd
lgeefagrgsvpilekvskglgiafsnaktwkemrrfslmtlrnfgmgkrsiedriqeea
rclveelrktnaspcdptfilgcapcnvicsvifhnrfdykdeeflklmeslhenvellg
tpldyfpgihktllknadyiknfimekvkehqklldvnnprdfidcflikmeqennleft
leslviavsdlfgagtettsttlryslllllkhpevaarvqeeiervigrhrspcmqdrs
rmpytdaviheiqrfidllptnlphavtrdvrfrnyfipkgtdiitsltsvlhdekafpn
pkvfdpghfldesgnfkksdyfmpfsagkrmcvgeglarmelflfltsilqnfklqslve
pkdlditavvngfvsvppsyqlcfipihh

SCOPe Domain Coordinates for d1dt6a_:

Click to download the PDB-style file with coordinates for d1dt6a_.
(The format of our PDB-style files is described here.)

Timeline for d1dt6a_: