![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
![]() | Protein Cyp119 [48278] (3 species) thermophilic P450 |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [48279] (6 PDB entries) |
![]() | Domain d1f4tb_: 1f4t B: [18974] complexed with hem, pim, so4, zn |
PDB Entry: 1f4t (more details), 1.93 Å
SCOPe Domain Sequences for d1f4tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f4tb_ a.104.1.1 (B:) Cyp119 {Sulfolobus solfataricus [TaxId: 2287]} mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl vvrlksn
Timeline for d1f4tb_: