Lineage for d1f4ta_ (1f4t A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5730Fold a.104: Cytochrome P450 [48263] (1 superfamily)
  4. 5731Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 5732Family a.104.1.1: Cytochrome P450 [48265] (8 proteins)
  6. 5733Protein CYP119 [48278] (1 species)
  7. 5734Species Sulfolobus solfataricus [TaxId:2287] [48279] (3 PDB entries)
  8. 5737Domain d1f4ta_: 1f4t A: [18973]

Details for d1f4ta_

PDB Entry: 1f4t (more details), 1.93 Å

PDB Description: thermophilic p450: cyp119 from sulfolobus solfactaricus with 4-phenylimidazole bound

SCOP Domain Sequences for d1f4ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4ta_ a.104.1.1 (A:) CYP119 {Sulfolobus solfataricus}
mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
vvrlksn

SCOP Domain Coordinates for d1f4ta_:

Click to download the PDB-style file with coordinates for d1f4ta_.
(The format of our PDB-style files is described here.)

Timeline for d1f4ta_: